Tear Pack 1 »

Tear Long Mix Color Video Loop

Loading Tear Long Mix Color

Video preview shown at low quality. There's no Free Loops logo on the video file.

An extended tearing sequence blending multiple directions, shapes, and colors in vivid motion. Excellent for layered compositions and seamless loop transitions.
ResolutionFPSCodecContainerDownload
HD (1920x1080)25 FPSDXVMOVDownload
HD (1920x1080)25 FPSH264MP4Download
HD (1920x1080)25 FPSPJPEGMOVDownload
HD (1920x1080)25 FPSPNGMOVDownload
The DXV and PNG versions of this video loop have a transparent background.

Tags

abstractcolorfulanimemaskclawsprimarypaperteartransitioncartoon
 

People who downloaded this video also liked

Download   Emerging Particles 3
Download   Dr Dots Colored Multi
Download   Pulse Arrows Circle 2
Download   Hexagon Stacked
Download   Snowflakes Blue Close
Download   Energy Waves 6
Free Loops in official selection of TNW Boost Free Loops is proudly part of Startup Delta Free Loops is a Microsoft BizSpark+ startup